Clinical trials
Full profile accessFollow clinical development from study design and recruitment through results.
- Trial phase
- Status
- Readouts
Drug intelligence / Profile preview
HPV16 E7 43-77 peptide
- Development stage
- Preclinical
- Lead developer
- China Medical University
- Modality
- Peptides, Vaccines & Immunotherapeutics
- Administration
- Subcutaneous
01
Overview
HPV16 E7 43-77 peptide is a therapeutic peptide vaccine candidate designed to treat malignancies associated with Human Papillomavirus type 16 (HPV16), particularly cervical cancer. The peptide consists of a 35-amino acid sequence from the HPV16 E7 oncoprotein that encompasses a cytotoxic T lymphocyte (CTL) epitope (E7 49-57) and two T-helper (Th) epitopes (E7 50-62 and E7 43-77). By targeting these epitopes, the vaccine induces robust systemic and local cellular immune responses, characterized by an increase in IFN-γ-producing CD4+ and CD8+ T cells. Furthermore, it has been shown to modulate the tumor microenvironment by reducing the presence of immunosuppressive cells such as myeloid-derived suppressor cells (MDSCs), regulatory T cells (Tregs), and M2-polarized tumor-associated macrophages, thereby reversing tumor-induced immune evasion.
- Other names
- HPV16 E7 peptide (43-77)GQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIR
02
Targets
Major histocompatibility complex class II presenting human papillomavirus type 16 E7 epitopesHPV16 E7 TCR (HPV16 E7-specific T-cell receptor)pMHC-I (Peptide–MHC class I complex)
Beyond the preview
Go deeper on HPV16 E7 43-77 peptide.
Explore the evidence, development activity, and competitive landscape with Gosset’s full data platform.
Indications & development
Full profile accessExplore development by indication, patient population, and geography.
- Indications
- Development status
- Countries
Licensing & deals
Full profile accessTrace asset ownership, licensing agreements, and commercial partnerships.
- Partners
- Deal terms
- Milestones
Patents & exclusivity
Full profile accessExplore the patent landscape and regulatory exclusivity around an asset.
- Patents
- Expiration dates
- Exclusivity
Competitive landscape
Full profile accessCompare development programs by target, modality, and indication.
- Competing assets
- Targets
- Development stage
Research & analysis
Full profile accessConnect source evidence and development news to your research questions.
- Publications
- News
- Analysis
Bring the full picture into focus.
See how Gosset can support your research on HPV16 E7 43-77 peptide.